PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000868556
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 295aa    MW: 33860.7 Da    PI: 6.8837
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000868556genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.93e-47191453128
            NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                    pGfrFhPt+eel+ +yLk  v gk+l++ ++i  ++iy+++PwdLp   k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d++++s    
  MDP0000868556  19 PGFRFHPTEEELLEFYLKSMVFGKRLRF-DIIGFLNIYHHDPWDLPGLSKIGEREWYFFVPRDRKHGSGGRPNRTTETGFWKATGSDRKIVSLsnP 113
                    9*************************99.99***************8778899*************************************997556 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++ +gl+ktLvfykgrap+g+ktdWvm+eyrl
  MDP0000868556 114 KRIIGLRKTLVFYKGRAPRGSKTDWVMNEYRL 145
                    777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-5717163IPR003441NAC domain
PROSITE profilePS5100554.66917163IPR003441NAC domain
PfamPF023654.5E-2519145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAANTIEPDH QMTPEFELPG FRFHPTEEEL LEFYLKSMVF GKRLRFDIIG FLNIYHHDPW  60
DLPGLSKIGE REWYFFVPRD RKHGSGGRPN RTTETGFWKA TGSDRKIVSL SNPKRIIGLR  120
KTLVFYKGRA PRGSKTDWVM NEYRLPDNCQ YLKDIVLCKI YRKATSLKVL EQMAAIEGDQ  180
IKNLHASPNS SPPPTSMDTI SFCSQALQED LTPQISTNHV VFKQEIEDAA LVIAQEQKDE  240
NAMEIKGSPP PPMYNLPELQ VPKFSMDWTQ DTVWTQMNSP WLQNLTPLAN ILNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-471916317168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392474.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLM5VLG71e-180M5VLG7_PRUPE; Uncharacterized protein
STRINGGLYMA11G10230.11e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62143251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-117NAC domain containing protein 36